Overview
Choose your reading level:
In plain language
Exenatide was the first drug of its kind for type 2 diabetes, approved in 2005. It is a lab-made copy of a peptide found in the saliva of the Gila monster, a venomous lizard.
That lizard peptide acts like our own gut hormone GLP-1, which helps release insulin when blood sugar is high, but it lasts much longer in the body. Exenatide opened the door to today's GLP-1 medicines such as semaglutide. Which forms are sold has changed over time.
For students
Exenatide is synthetic exendin-4, a 39-residue peptide (about 4,187 Da) from Heloderma suspectum venom, discovered by John Eng in the early 1990s. It shares about 53% sequence identity with human GLP-1.
A glycine at position 2 (alanine in GLP-1) makes it resistant to the enzyme DPP-4, and its C-terminal "Trp-cage" extension adds stability. It activates the GLP-1 receptor, increasing glucose-dependent insulin release, suppressing glucagon and slowing gastric emptying. It was first given twice daily (Byetta) and later as a once-weekly microsphere formulation (Bydureon).
For researchers and instructors
Pharmacokinetics. Cleared mainly by the kidneys; not recommended in severe renal impairment.
Clinical evidence. Phase 3 trials showed HbA1c reductions and modest weight loss. The EXSCEL cardiovascular outcomes trial of weekly exenatide showed non-inferiority but did not show significant superiority for major cardiovascular events.
Safety. Nausea and vomiting; reports of pancreatitis; immunogenicity (anti-exenatide antibodies) is more frequent than with human-based GLP-1 analogues. Weekly forms carry the rodent thyroid C-cell tumor boxed warning.
History. A landmark in drug discovery from animal venoms. Availability of individual formulations has changed over time.
Molecular identity
- Amino acids
- 39
- Molecular weight
- ~4,186.6 Da
- Formula
- C₁₈₄H₂₈₂N₅₀O₆₀S
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Sequence map
Hydropathy
Kyte–Doolittle score per residue. Positive values are water-repelling.
Origin and history
Exenatide came from the venom of the Gila monster, a lizard of the American Southwest. In 1992 John Eng, an endocrinologist at the Bronx VA Medical Center in New York, isolated exendin-4 from its saliva and found it acts like GLP-1 but resists breakdown.
Eng patented it and licensed it to Amylin Pharmaceuticals in 1996. In April 2005 it became the first approved GLP-1 drug, Byetta, launching the drug class that led to Ozempic and Mounjaro.
Key people
- John EngEndocrinologist, Bronx VA Medical Center
Timeline
- 1992
Exendin-4 isolated from Gila monster venom
- 1996
Licensed to Amylin Pharmaceuticals
- 2005
Byetta approved
- 2012
Once-weekly Bydureon approved
See every peptide on one history timeline.
Human evidence
Randomized trials support its use in type 2 diabetes.
Registration and enrollment are not proof of benefit; check study results directly.
Explore original publications and distinguish preclinical findings from controlled human evidence.
Safety and regulatory status
See every compound on the regulatory tracker.
FDA-approved for type 2 diabetes; availability of individual formulations has changed over time.
This profile is educational and does not provide treatment, dosing or sourcing guidance.
Sources
- PubMed literature search: Exenatide
- PubChem compound search: Exenatide
- DailyMed (FDA label search): Exenatide
- Eng et al. 1992, J Biol Chem
- ClinicalTrials.gov search: Exenatide
Hernandez Gener, E. (2026, November 7). Exenatide: molecular data, research history and evidence. VALREXA Biosciences. https://valrexa.com/peptides/exenatide.html
APA style · Last reviewed November 7, 2026 · Our editorial standardsLast reviewed November 7, 2026. Trial and regulatory status can change; confirm in the linked registries. This profile is educational and is not medical advice, a treatment recommendation, or dosing or sourcing guidance. Report an error · Corrections policy