Overview
Choose your reading level:
In plain language
Amylin is a natural 37-amino-acid hormone released with insulin by pancreatic beta cells. It helps regulate food intake and glucose handling by promoting satiation, slowing gastric emptying and limiting post-meal glucagon release. (Le Foll & Lutz, 2026)
Native human amylin can aggregate under certain conditions. Pramlintide is a modified amylin analogue, not the same molecule: its FDA-approved role is as an adjunct to mealtime insulin in specified patients with diabetes. (Le Foll & Lutz, 2026) (FDA Symlin label, 2015)
Pramlintide used with insulin carries a boxed warning for severe hypoglycemia. Approval of an analogue does not make native amylin, other analogues or unrelated products approved treatments. (FDA Symlin label, 2015)
For students
Amylin is also called islet amyloid polypeptide (IAPP). Its physiological actions and its aggregation into islet amyloid are related but different subjects; aggregation depends on sequence and conditions. (Le Foll & Lutz, 2026)
Amylin receptors combine the calcitonin receptor with RAMP1, RAMP2 or RAMP3, yielding AMY1, AMY2 or AMY3 receptor complexes. Receptor pharmacology should not be equated with evidence of clinical benefit. (Le Foll & Lutz, 2026)
Pramlintide contains proline substitutions at positions 25, 28 and 29 relative to human amylin. The linked FDA label provides the chemical description, approved clinical context and safety warnings for that specific analogue. (FDA Symlin label, 2015)
For researchers and instructors
Aggregation. The 2026 review discusses IAPP aggregation as a contributor to beta-cell dysfunction and loss under relevant conditions. The physiological monomer, soluble aggregates and mature fibrils should not be treated as interchangeable entities. (Le Foll & Lutz, 2026)
Translation. A physiological hormone, an engineered analogue and a formulated medicine are separate evidentiary objects. Pramlintide's approval does not validate all proposed amylin-pathway applications; the historical label cited here is not a substitute for checking current prescribing information. (FDA Symlin label, 2015)
Research context. The 2026 review discusses long-acting analogues and cagrilintide–semaglutide research. Those dated descriptions are not a claim about the present approval status of every candidate or combination. (Le Foll & Lutz, 2026)
Molecular identity
- Amino acids
- 37
- Molecular weight
- ~3,903.3 Da
- Formula
- C₁₆₅H₂₆₁N₅₁O₅₅S₂
- Sequence
- KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Cys2–Cys7 disulfide)
Sequence map
Hydropathy
Kyte–Doolittle score per residue. Positive values are water-repelling.
Origin and history
Amylin/IAPP emerged from work on pancreatic islet amyloid in the mid-1980s. Cooper and colleagues reported purification of a 37-amino-acid peptide from amyloid-rich pancreases of people with type 2 diabetes in 1987. (Le Foll & Lutz, 2026) (Cooper et al., 1987)
This discovery connected a physiological hormone with protein-aggregation research. Later analogue development is a separate story: the 2015 FDA Symlin label documents pramlintide's chemical substitutions, indication and safety limitations. (FDA Symlin label, 2015)
Human evidence
The native hormone has human physiological evidence. The Early human category here does not describe every analogue: pramlintide has its own FDA-approved product and safety requirements. Neither that approval nor a study of another analogue establishes approval of native human amylin. (Le Foll & Lutz, 2026) (FDA Symlin label, 2015)
Safety and regulatory status
Native amylin is not interchangeable with pramlintide. The latter's label includes a boxed warning for severe hypoglycemia when used with insulin. This is a non-exhaustive educational distinction, not prescribing advice; the linked 2015 label is a dated regulatory reference. (FDA Symlin label, 2015)
Editorial update · November 9, 2026
Separated the native hormone from pramlintide, added direct physiology and drug-label references, and removed an unsupported company-founding date. An analogue's approval is not approval of native amylin.
Sources
- Le Foll & Lutz, 2026https://pmc.ncbi.nlm.nih.gov/articles/PMC13588233/
- Cooper et al., 1987http://www.ncbi.nlm.nih.gov/pmc/articles/PMC299599
- FDA Symlin label, 2015https://www.accessdata.fda.gov/drugsatfda_docs/label/2015/021332s025lbl.pdf
Hernandez Gener, E. (2026, November 9). Amylin: molecular data, research history and evidence. VALREXA Biosciences. https://valrexa.com/peptides/amylin.html
APA style · Editorially updated November 9, 2026 · Our editorial standardsEditorially updated November 9, 2026. Trial and regulatory status can change; confirm in the linked registries. This profile is educational and is not medical advice, a treatment recommendation, or dosing or sourcing guidance. Report an error · Corrections policy